JunD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11955T
Artikelname: JunD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11955T
Hersteller Artikelnummer: CNA11955T
Alternativnummer: MBL-CNA11955T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3).
Konjugation: Unconjugated
Alternative Synonym: AP-1
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 3727
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPE
Target-Kategorie: JUND
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100