PDGFB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1195P
Artikelname: PDGFB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1195P
Hersteller Artikelnummer: CNA1195P
Alternativnummer: MBL-CNA1195P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 142-241 of human PDGFB (NP_002599.1).
Konjugation: Unconjugated
Alternative Synonym: SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 5155
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA
Target-Kategorie: PDGFB
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200