POLK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11967T
Artikelname: POLK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11967T
Hersteller Artikelnummer: CNA11967T
Alternativnummer: MBL-CNA11967T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human POLK (NP_057302.1).
Konjugation: Unconjugated
Alternative Synonym: DINP, POLQ, DINB1
Klonalität: Polyclonal
Molekulargewicht: 99kDa
NCBI: 51426
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLS
Target-Kategorie: POLK
Application Verdünnung: WB: WB,1:500 - 1:2000