ATG16L1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11969T
Artikelname: ATG16L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11969T
Hersteller Artikelnummer: CNA11969T
Alternativnummer: MBL-CNA11969T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5).
Konjugation: Unconjugated
Alternative Synonym: IBD10, WDR30, APG16L, ATG16A, ATG16L
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 55054
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Target-Kategorie: ATG16L1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200