FHIT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1196S
Artikelname: FHIT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1196S
Hersteller Artikelnummer: CNA1196S
Alternativnummer: MBL-CNA1196S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-147 of human FHIT (NP_001159715.1).
Konjugation: Unconjugated
Alternative Synonym: FRA3B, AP3Aase
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 2272
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
Target-Kategorie: FHIT
Application Verdünnung: WB: WB,1:500 - 1:2000