PGC1alpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11971P
Artikelname: PGC1alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11971P
Hersteller Artikelnummer: CNA11971P
Alternativnummer: MBL-CNA11971P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 610-798 of human PGC1alpha (NP_037393.1).
Konjugation: Unconjugated
Alternative Synonym: LEM6, PGC1, PGC1A, PGC-1v, PPARGC1, PGC-1alpha, PGC-1(alpha)
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 10891
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Target-Kategorie: PPARGC1A
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200