SLC5A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA11976P
| Artikelname: |
SLC5A1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA11976P |
| Hersteller Artikelnummer: |
CNA11976P |
| Alternativnummer: |
MBL-CNA11976P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC5A1 (NP_000334.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NAGT, SGLT1, SGLT-1, D22S675 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
73kDa |
| NCBI: |
6523 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
ECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSG |
| Target-Kategorie: |
SLC5A1 |
| Application Verdünnung: |
WB: WB,1:100 - 1:500 |
