BYSL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11993T
Artikelname: BYSL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11993T
Hersteller Artikelnummer: CNA11993T
Alternativnummer: MBL-CNA11993T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BYSL (NP_004044.3).
Konjugation: Unconjugated
Alternative Synonym: Enp1, BYSTIN
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 705
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HAEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL
Target-Kategorie: BYSL
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100