CAPN3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11995T
Artikelname: CAPN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11995T
Hersteller Artikelnummer: CNA11995T
Alternativnummer: MBL-CNA11995T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CAPN3 (NP_775111.1).
Konjugation: Unconjugated
Alternative Synonym: p94, CANP3, LGMD2, nCL-1, CANPL3, LGMD2A, LGMDD4, LGMDR1
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 825
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIA
Target-Kategorie: CAPN3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200