HR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11996T
Artikelname: HR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11996T
Hersteller Artikelnummer: CNA11996T
Alternativnummer: MBL-CNA11996T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-480 of human HR (NP_005135.2).
Konjugation: Unconjugated
Alternative Synonym: AU, MUHH, ALUNC, HYPT4, MUHH1, HSA277165
Klonalität: Polyclonal
Molekulargewicht: 127kDa
NCBI: 55806
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLGSKGFYYKDPSIPRLAKEPLAAAEPGLFGLNSGGHLQRAGEAERPSLHQRDGEMGAGRQQNPCPLFLGQPDTVPWTSWPACPPGLVHTLGNVWAGPGDGNLGYQLGPPATPRCPSPEPPVTQRGCCSSYPPTKGGGLGPCGKCQEGLEGGASGASEPSEEVNKASGPRACPPSHHTKLKKTWLTRHSEQFECPRGCPEVEERPVARLRALKRAGSPEVQGAMGSPAPKRPPDPFPGTAEQGAGGWQEVRDTS
Target-Kategorie: HR
Application Verdünnung: WB: WB,1:500 - 1:1000