Ser/thr-PP2A activator (PTPA) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11999T
Artikelname: Ser/thr-PP2A activator (PTPA) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11999T
Hersteller Artikelnummer: CNA11999T
Alternativnummer: MBL-CNA11999T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 58-240 of human Ser/thr-PP2A activator (PTPA) (NP_821068.1).
Konjugation: Unconjugated
Alternative Synonym: PP2A, PR53, PPP2R4
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 5524
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
Target-Kategorie: PTPA
Application Verdünnung: WB: WB,1:500 - 1:2000