CD86 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1199P
Artikelname: CD86 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1199P
Hersteller Artikelnummer: CNA1199P
Alternativnummer: MBL-CNA1199P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-133 of human CD86 (NP_787058.4).
Konjugation: Unconjugated
Alternative Synonym: B70, B7-2, B7.2, LAB72, CD28LG2
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 942
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL
Target-Kategorie: CD86
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200