S100A8 Rabbit mAb, Clone: [ARC0478], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12018S
Artikelname: S100A8 Rabbit mAb, Clone: [ARC0478], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12018S
Hersteller Artikelnummer: CNA12018S
Alternativnummer: MBL-CNA12018S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-93 of human S100A8 (P05109).
Konjugation: Unconjugated
Alternative Synonym: P8, MIF, NIF, CAGA, CFAG, CGLA, L1Ag, MRP8, CP-10, MA387, 60B8AG, S100-A8
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0478]
Molekulargewicht: 11kDa
NCBI: 6279
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Target-Kategorie: S100A8
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200