MYH10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12029T
Artikelname: MYH10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12029T
Hersteller Artikelnummer: CNA12029T
Alternativnummer: MBL-CNA12029T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1).
Konjugation: Unconjugated
Alternative Synonym: NMMHCB, NMMHC-IIB
Klonalität: Polyclonal
Molekulargewicht: 229kDa
NCBI: 4628
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE
Target-Kategorie: MYH10
Application Verdünnung: WB: WB,1:500 - 1:2000