PIBF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12033T
Artikelname: PIBF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12033T
Hersteller Artikelnummer: CNA12033T
Alternativnummer: MBL-CNA12033T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 598-757 of human PIBF1 (NP_006337.2).
Konjugation: Unconjugated
Alternative Synonym: PIBF, CEP90, JBTS33, C13orf24
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 10464
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LEHRKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQLEKDVSNLNKEKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKMKT
Target-Kategorie: PIBF1
Application Verdünnung: WB: WB,1:500 - 1:2000