XPOT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12043T
Artikelname: XPOT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12043T
Hersteller Artikelnummer: CNA12043T
Alternativnummer: MBL-CNA12043T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human XPOT (NP_009166.2).
Konjugation: Unconjugated
Alternative Synonym: XPO3
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 11260
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSE
Target-Kategorie: XPOT
Application Verdünnung: WB: WB,1:500 - 1:2000