SYNPO Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12049T
Artikelname: SYNPO Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12049T
Hersteller Artikelnummer: CNA12049T
Alternativnummer: MBL-CNA12049T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human SYNPO (NP_001159680.1).
Konjugation: Unconjugated
Alternative Synonym: SYNPO
Klonalität: Polyclonal
Molekulargewicht: 99kDa
NCBI: 11346
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSLDLVPNLPKGALPPSPALPRPSRSSPGLYTSPGQDSLQPTAVSPPYGGDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK
Target-Kategorie: SYNPO
Application Verdünnung: WB: WB,1:500 - 1:2000