MEF2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12059P
Artikelname: MEF2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12059P
Hersteller Artikelnummer: CNA12059P
Alternativnummer: MBL-CNA12059P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEF2A (NP_001124400.1).
Konjugation: Unconjugated
Alternative Synonym: mef2, ADCAD1, RSRFC4, RSRFC9
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 4205
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MGRKKIQITRIMDERNRQTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
Target-Kategorie: MEF2A
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200