SCRN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1205S
Artikelname: SCRN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1205S
Hersteller Artikelnummer: CNA1205S
Alternativnummer: MBL-CNA1205S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 176-425 of human SCRN2 (NP_612364.2).
Konjugation: Unconjugated
Alternative Synonym: Ses2
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 90507
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GRLWAAQRIQEGARNISNQLSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDSGGFRTTASMVSVLPQDPTQPCVHFLTATPDPSRSVFKPFIFGMGVAQAPQVLSPTFGAQDPVRTLPRFQTQVDRRHTLYRGHQAALGLMERDQDRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRESQAYA
Target-Kategorie: SCRN2
Application Verdünnung: WB: WB,1:500 - 1:2000