OLR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12060T
Artikelname: OLR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12060T
Hersteller Artikelnummer: CNA12060T
Alternativnummer: MBL-CNA12060T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human OLR1 (NP_002534.1).
Konjugation: Unconjugated
Alternative Synonym: LOX1, LOXIN, SLOX1, CLEC8A, SCARE1
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 4973
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESEN
Target-Kategorie: OLR1
Application Verdünnung: WB: WB,1:500 - 1:1000