GIGYF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12069T
Artikelname: GIGYF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12069T
Hersteller Artikelnummer: CNA12069T
Alternativnummer: MBL-CNA12069T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-500 of human GIGYF2 (NP_001096617.1).
Konjugation: Unconjugated
Alternative Synonym: GYF2, PERQ2, PERQ3, PARK11, TNRC15
Klonalität: Polyclonal
Molekulargewicht: 150kDa
NCBI: 26058
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTDRVGVASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPAKVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVS
Target-Kategorie: GIGYF2
Application Verdünnung: WB: WB,1:500 - 1:1000