STAT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12075T
Artikelname: STAT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12075T
Hersteller Artikelnummer: CNA12075T
Alternativnummer: MBL-CNA12075T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human STAT1 (NP_009330.1).
Konjugation: Unconjugated
Alternative Synonym: CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 6772
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Target-Kategorie: STAT1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000