PKLR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12084T
Artikelname: PKLR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12084T
Hersteller Artikelnummer: CNA12084T
Alternativnummer: MBL-CNA12084T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1).
Konjugation: Unconjugated
Alternative Synonym: PK1, PKL, RPK, PKRL
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 5313
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PLSRDPTEVTAIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVT
Target-Kategorie: PKLR
Application Verdünnung: WB: WB,1:500 - 1:2000