MRPS18B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12085T
Artikelname: MRPS18B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12085T
Hersteller Artikelnummer: CNA12085T
Alternativnummer: MBL-CNA12085T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human MRPS18B (NP_054765.1).
Konjugation: Unconjugated
Alternative Synonym: PTD017, S18amt, C6orf14, HSPC183, MRPS18-2, HumanS18a, MRP-S18-2
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 28973
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGP
Target-Kategorie: MRPS18B
Application Verdünnung: WB: WB,1:500 - 1:2000