Sec23A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12101T
Artikelname: Sec23A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12101T
Hersteller Artikelnummer: CNA12101T
Alternativnummer: MBL-CNA12101T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Sec23A (NP_006355.2).
Konjugation: Unconjugated
Alternative Synonym: CLSD, hSec23A
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 10484
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCMEDEDLQALKES
Target-Kategorie: SEC23A
Application Verdünnung: WB: WB,1:500 - 1:2000