SPOP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12106T
Artikelname: SPOP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12106T
Hersteller Artikelnummer: CNA12106T
Alternativnummer: MBL-CNA12106T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-374 of human SPOP (NP_001007227.1).
Konjugation: Unconjugated
Alternative Synonym: TEF2, BTBD32, NSDVS1, NSDVS2, NEDMACE, NEDMIDF
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 8405
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Target-Kategorie: SPOP
Application Verdünnung: WB: WB,1:500 - 1:1000