TATDN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12107T
Artikelname: TATDN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12107T
Hersteller Artikelnummer: CNA12107T
Alternativnummer: MBL-CNA12107T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human TATDN1 (NP_114415.1).
Konjugation: Unconjugated
Alternative Synonym: CDA11
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 83940
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMFFSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCL
Target-Kategorie: TATDN1
Application Verdünnung: WB: WB,1:500 - 1:2000