NDUFA8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12118T
Artikelname: NDUFA8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12118T
Hersteller Artikelnummer: CNA12118T
Alternativnummer: MBL-CNA12118T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 33-172 of human NDUFA8 (NP_055037.1).
Konjugation: Unconjugated
Alternative Synonym: PGIV, CI-19KD, CI-PGIV, MC1DN37
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 4702
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Target-Kategorie: NDUFA8
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100