AIFM2/FSP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12128P
Artikelname: AIFM2/FSP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12128P
Hersteller Artikelnummer: CNA12128P
Alternativnummer: MBL-CNA12128P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 43-371 of human AIFM2/FSP1/AMID/AMID (NP_116186.1).
Konjugation: Unconjugated
Alternative Synonym: AMID, FSP1, PRG3
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 84883
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAY
Target-Kategorie: AIFM2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200