CA3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1212S
Artikelname: CA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1212S
Hersteller Artikelnummer: CNA1212S
Alternativnummer: MBL-CNA1212S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CA3 (NP_005172.1).
Konjugation: Unconjugated
Alternative Synonym: Car3, CAIII
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 761
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRV
Target-Kategorie: CA3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200