SLC25A24 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12138T
Artikelname: SLC25A24 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12138T
Hersteller Artikelnummer: CNA12138T
Alternativnummer: MBL-CNA12138T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC25A24 (NP_037518.3).
Konjugation: Unconjugated
Alternative Synonym: APC1, SCAMC1, SCAMC-1
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 29957
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
Target-Kategorie: SLC25A24
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200