DTL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12150T
Artikelname: DTL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12150T
Hersteller Artikelnummer: CNA12150T
Alternativnummer: MBL-CNA12150T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 541-730 of human DTL (NP_057532.3).
Konjugation: Unconjugated
Alternative Synonym: CDT2, RAMP, DCAF2, L2DTL
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 51514
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSKDSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENKNWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKTLPSPVTITPSSMRKICTYFHRKSQEDFCGPEHSTEL
Target-Kategorie: DTL
Application Verdünnung: WB: WB,1:500 - 1:2000