SNRPA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12161T
Artikelname: SNRPA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12161T
Hersteller Artikelnummer: CNA12161T
Alternativnummer: MBL-CNA12161T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SNRPA1 (NP_003081.2).
Konjugation: Unconjugated
Alternative Synonym: Lea1, U2A
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 6627
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL
Target-Kategorie: SNRPA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200