SNRPF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12162T
Artikelname: SNRPF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12162T
Hersteller Artikelnummer: CNA12162T
Alternativnummer: MBL-CNA12162T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1).
Konjugation: Unconjugated
Alternative Synonym: SMF, Sm-F, snRNP-F
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 6636
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Target-Kategorie: SNRPF
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200