GPN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12167T
Artikelname: GPN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12167T
Hersteller Artikelnummer: CNA12167T
Alternativnummer: MBL-CNA12167T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-388 of human GPN1 (NP_009197.2).
Konjugation: Unconjugated
Alternative Synonym: XAB1, MBDIN, NTPBP, RPAP4, ATPBD1A
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 11321
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
Target-Kategorie: GPN1
Application Verdünnung: WB: WB,1:500 - 1:2000