PMEPA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12171T
Artikelname: PMEPA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12171T
Hersteller Artikelnummer: CNA12171T
Alternativnummer: MBL-CNA12171T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1).
Konjugation: Unconjugated
Alternative Synonym: STAG1, TMEPAI
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 56937
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Target-Kategorie: PMEPA1
Application Verdünnung: WB: WB,1:500 - 1:2000