PPIH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12172T
Artikelname: PPIH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12172T
Hersteller Artikelnummer: CNA12172T
Alternativnummer: MBL-CNA12172T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-177 of human PPIH (NP_006338.1).
Konjugation: Unconjugated
Alternative Synonym: CYPH, CYP-20, USA-CYP, SnuCyp-20
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 10465
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Target-Kategorie: PPIH
Application Verdünnung: WB: WB,1:500 - 1:2000