FAU Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12181T
Artikelname: FAU Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12181T
Hersteller Artikelnummer: CNA12181T
Alternativnummer: MBL-CNA12181T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FAU (NP_001988.1).
Konjugation: Unconjugated
Alternative Synonym: S30, FAU1, Fub1, Fubi, asr1, eS30, RPS30, MNSFbeta
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 2197
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Target-Kategorie: FAU
Application Verdünnung: WB: WB,1:500 - 1:2000