PDE8A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12187T
Artikelname: PDE8A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12187T
Hersteller Artikelnummer: CNA12187T
Alternativnummer: MBL-CNA12187T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1).
Konjugation: Unconjugated
Alternative Synonym: HsT19550
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 5151
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
Target-Kategorie: PDE8A
Application Verdünnung: WB: WB,1:500 - 1:2000