AK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1218S
Artikelname: AK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1218S
Hersteller Artikelnummer: CNA1218S
Alternativnummer: MBL-CNA1218S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human AK1 (NP_000467.1).
Konjugation: Unconjugated
Alternative Synonym: HTL-S-58j
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 203
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Target-Kategorie: AK1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200