ATL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12196T
Artikelname: ATL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12196T
Hersteller Artikelnummer: CNA12196T
Alternativnummer: MBL-CNA12196T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-440 of human ATL3 (NP_056274.3).
Konjugation: Unconjugated
Alternative Synonym: HSN1F
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 25923
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFST
Target-Kategorie: ATL3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200