CSMD3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12199T
Artikelname: CSMD3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12199T
Hersteller Artikelnummer: CNA12199T
Alternativnummer: MBL-CNA12199T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-440 of human CSMD3 (NP_937756.1).
Konjugation: Unconjugated
Alternative Synonym: CSMD3
Klonalität: Polyclonal
Molekulargewicht: 406kDa
NCBI: 114788
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ANSVNTASWDFPVPICRAEDACGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRPRHAEQIERTKE
Target-Kategorie: CSMD3
Application Verdünnung: WB: WB,1:500 - 1:2000