DNAL4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12208T
Artikelname: DNAL4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12208T
Hersteller Artikelnummer: CNA12208T
Alternativnummer: MBL-CNA12208T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human DNAL4 (NP_005731.1).
Konjugation: Unconjugated
Alternative Synonym: MRMV3, PIG27
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 10126
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Target-Kategorie: DNAL4
Application Verdünnung: WB: WB,1:500 - 1:2000