HRAS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12212T
Artikelname: HRAS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12212T
Hersteller Artikelnummer: CNA12212T
Alternativnummer: MBL-CNA12212T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human HRAS (NP_005334.1).
Konjugation: Unconjugated
Alternative Synonym: CTLO, HAMSV, HRAS1, RASH1, p21ras, C-H-RAS, H-RASIDX, C-BAS/HAS, C-HA-RAS1
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 3265
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
Target-Kategorie: HRAS
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200