NCKAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12229T
Artikelname: NCKAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12229T
Hersteller Artikelnummer: CNA12229T
Alternativnummer: MBL-CNA12229T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCKAP1 (NP_038464.1).
Konjugation: Unconjugated
Alternative Synonym: HEM2, NAP1, NAP125, p125Nap1
Klonalität: Polyclonal
Molekulargewicht: 129kDa
NCBI: 10787
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPC
Target-Kategorie: NCKAP1
Application Verdünnung: WB: WB,1:500 - 1:2000