Aromatase (CYP19A1) Rabbit mAb, Clone: [ARC0635], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12238S
Artikelname: Aromatase (CYP19A1) Rabbit mAb, Clone: [ARC0635], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12238S
Hersteller Artikelnummer: CNA12238S
Alternativnummer: MBL-CNA12238S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511).
Konjugation: Unconjugated
Alternative Synonym: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0635]
Molekulargewicht: 58kDa
NCBI: 1588
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
Target-Kategorie: CYP19A1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200