RRBP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12239T
Artikelname: RRBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12239T
Hersteller Artikelnummer: CNA12239T
Alternativnummer: MBL-CNA12239T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2).
Konjugation: Unconjugated
Alternative Synonym: RRp, hES, p180, ES130, ES/130
Klonalität: Polyclonal
Molekulargewicht: 152kDa
NCBI: 6238
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK
Target-Kategorie: RRBP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200