SHARPIN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12240P
Artikelname: SHARPIN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12240P
Hersteller Artikelnummer: CNA12240P
Alternativnummer: MBL-CNA12240P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SHARPIN (NP_112236.3).
Konjugation: Unconjugated
Alternative Synonym: SIPL1
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 81858
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLT
Target-Kategorie: SHARPIN
Application Verdünnung: WB: WB,1:500 - 1:1000