PORCN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12250T
Artikelname: PORCN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12250T
Hersteller Artikelnummer: CNA12250T
Alternativnummer: MBL-CNA12250T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).
Konjugation: Unconjugated
Alternative Synonym: PPN, DHOF, FODH, MG61, PORC
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 64840
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG
Target-Kategorie: PORCN
Application Verdünnung: WB: WB,1:500 - 1:1000