SIPA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12253T
Artikelname: SIPA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12253T
Hersteller Artikelnummer: CNA12253T
Alternativnummer: MBL-CNA12253T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 763-1042 of human SIPA1 (NP_694985.29).
Konjugation: Unconjugated
Alternative Synonym: SPA1
Klonalität: Polyclonal
Molekulargewicht: 112kDa
NCBI: 6494
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ESGRPRRSFSELYTLSLQEPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSPRSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRL
Target-Kategorie: SIPA1
Application Verdünnung: WB: WB,1:500 - 1:2000